PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 887aa    MW: 99926.2 Da    PI: 8.3478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009008genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding301.2e-09367409446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      W  +E++ll+ +v+  G ++W+ Ia+ +gk+Rt+ qc +r+q 
      Lus10009008 367 WARQEEKLLLYYVQSKGIHNWSEIASLLGKKRTPFQCLERYQR 409
                      8899*************************************96 PP

2Myb_DNA-binding42.91.1e-13419461346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eEd +l+ av ++G  +W ++a t+  gRt+ qc +rw+k
      Lus10009008 419 EWTKEEDAQLKSAVCKFGESDWQSVATTLR-GRTGAQCSNRWLK 461
                      7*****************************.***********98 PP

3Myb_DNA-binding49.21.2e-15468512146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+W +eEd++l+ avk +G+++Wk++a+ ++ gR + qc++rw++
      Lus10009008 468 KGNWKAEEDKRLKLAVKFFGPKDWKKVASFVP-GRKDVQCRERWHN 512
                      79******************************.***********98 PP

4Myb_DNA-binding53.17.4e-17520564147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+WT eEd +l+ av+++G   W++++++++ gR +++c  rw  +
      Lus10009008 520 RGAWTDEEDSRLKAAVEEHGHS-WSKVSHYVP-GRNDNDCMRRWKVL 564
                      89******************88.*********.***********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.725263358IPR017877Myb-like domain
SMARTSM007170.86267360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-10270286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-10330371IPR009057Homeodomain-like
SuperFamilySSF466896.95E-12339396IPR009057Homeodomain-like
PROSITE profilePS500909.21359411IPR017877Myb-like domain
SMARTSM007172.7E-7363413IPR001005SANT/Myb domain
PfamPF139211.1E-12367428No hitNo description
Gene3DG3DSA:1.10.10.601.3E-11372420IPR009057Homeodomain-like
SuperFamilySSF466892.37E-19397465IPR009057Homeodomain-like
PROSITE profilePS5129411.905412462IPR017930Myb domain
SMARTSM007172.1E-9416465IPR001005SANT/Myb domain
CDDcd001671.83E-9419463No hitNo description
Gene3DG3DSA:1.10.10.601.4E-14421464IPR009057Homeodomain-like
PROSITE profilePS5129414.686463514IPR017930Myb domain
SMARTSM007171.2E-14467516IPR001005SANT/Myb domain
SuperFamilySSF466892.05E-25468561IPR009057Homeodomain-like
PfamPF002498.1E-14468512IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-21469521IPR009057Homeodomain-like
CDDcd001675.36E-12470512No hitNo description
PROSITE profilePS5129424.267515569IPR017930Myb domain
SMARTSM007179.2E-16519567IPR001005SANT/Myb domain
PfamPF002493.6E-15520563IPR001005SANT/Myb domain
CDDcd001673.42E-11522565No hitNo description
Gene3DG3DSA:1.10.10.601.2E-17522567IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 887 aa     Download sequence    Send to blast
MRTPEAENWG RLSDLTSDDE DDLDDALFND IEALREVCLK TGNTLGNTDN VCDDDEDNDD  60
GPSTSGRVVD SDSDEDDLEI LRSIQQRFMK SGKNYQALSP KPLCSIHPDT DDDDGEDDLE  120
MLVSLQRRFG TKGGIDANGG EIRSKRFEEE QTSIVTSEVK VSDEQLVGKT NAFRVVEDIQ  180
DTANNTANLL SERNLKDLQV SCRQNTGRSF AQGKNPRIQL ISAQSSISSK DAKGKDVKLS  240
PICSGPEENS HVPNYREALV KFPPSLERRK WEKSEDKNLK EGLKQQFQEI LFMEATDQFS  300
SSGHDGDTDS IIKSVENLEI TPEIMKKFLH KVDWNMVASR FVKGRSSPEC QARWLNSACP  360
DINNSGWARQ EEKLLLYYVQ SKGIHNWSEI ASLLGKKRTP FQCLERYQRS LNSRVLNKEW  420
TKEEDAQLKS AVCKFGESDW QSVATTLRGR TGAQCSNRWL KSLRLCGKGN WKAEEDKRLK  480
LAVKFFGPKD WKKVASFVPG RKDVQCRERW HNACSPSLNR GAWTDEEDSR LKAAVEEHGH  540
SWSKVSHYVP GRNDNDCMRR WKVLFPKEVK LLKEARKFRN AALITNFVDR EEERPALGLE  600
DFVTSPRLLP ESENVDQSGK SGRKRSNART KTRPNRTVKQ MQESLQAGGN GTADAGDAES  660
CGGSTAAGRK RRTLNRRRRT RKDHAQPPRE PSPDSICSPS RTKKVLLVYT RRKKGLDLKN  720
REANSSSEKD VEAPSSFNEV YTKGFGALRP HHRHEKDSHD VQEPWDNITL SSLRTSKKRK  780
RKLKIDDRSN IVVKDIGKAS YPPDDAQATS DSEATFSAEL QCRETSSHMS IDSSRSPPGS  840
NSVYSRKRKK IHGQAPVNQK HDDSKIDNAG ILRATSLDAC ESDVTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-303335704159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-303335704159MYB PROTO-ONCOGENE PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1675682RRRRTRKD
2776781KKRKRK
3845849RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPOPTR_0015s04260.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-139myb domain protein 4r1